Manufactured from only the highest quality low hydroxyl materials, Quartz reaction tubes from Exeter Analytical (www.exeteranalytical.co.uk) have demonstrated in laboratories throughout the world the ability to achieve consistent low level CHN blanks.

The high quality and consistency of Quartz reaction tubes from Exeter Analytical has enabled customers to achieve a level of precision and accuracy that's difficult to match.

Long experience in fine-tuning its automated production methodology allows Exeter Analytical to offer top quality low-hydroxyl quartz reaction tubes for most makes of CHN microanalyser at a competitive price.

With many materials produced under ISO 9001 accredited manufacturing conditions the consistent performance of Exeter Analytical consumables and supplies has removed this source of variability from microanalytical calculations. Commitment to supporting customers means the majority of items from Exeter's comprehensive CHN/O/S consumables and supplies catalogues can be supplied within 24 hours from stock.

As a company dedicated to elemental microanalysis, Exeter Analytical's nearly 30 years of involvement with instruments, consumables and supplies has allowed them to better understand the whole problem facing microanalysts. As a consequence whether you are a regular or an occasional purchaser - experienced and knowledgeable staff are always available to provide free informed advice.

For further information on how low-hydroxyl quartz reaction tubes can improve your CHN microanalytical data please contact Exeter Analytical.

-----------

European HQ

Exeter Analytical (UK) Ltd.
University of Warwick Science Park
Barclays Venture Centre
Sir William Lyons Road
Coventry CV4 7 EZ
UK

tel. +44-2476-323223
fax +44-2476-323221
email info@exeteranalytical.co.uk

-----

North America HQ

Exeter Analytical Inc
Chelmsford, MA USA

tel. +1-978-251-1411
fax +1-978-251-4536
Email sales@eai1.com

Manufactured from only the highest quality low hydroxyl materials, Quartz reaction tubes from Exeter Analytical (www.exeteranalytical.co.uk) have demonstrated in laboratories throughout the world the ability to achieve consistent low level CHN blanks.

The high quality and consistency of Quartz reaction tubes from Exeter Analytical has enabled customers to achieve a level of precision and accuracy that's difficult to match.

Long experience in fine-tuning its automated production methodology allows Exeter Analytical to offer top quality low-hydroxyl quartz reaction tubes for most makes of CHN microanalyser at a competitive price.

With many materials produced under ISO 9001 accredited manufacturing conditions the consistent performance of Exeter Analytical consumables and supplies has removed this source of variability from microanalytical calculations. Commitment to supporting customers means the majority of items from Exeter's comprehensive CHN/O/S consumables and supplies catalogues can be supplied within 24 hours from stock.

As a company dedicated to elemental microanalysis, Exeter Analytical's nearly 30 years of involvement with instruments, consumables and supplies has allowed them to better understand the whole problem facing microanalysts. As a consequence whether you are a regular or an occasional purchaser - experienced and knowledgeable staff are always available to provide free informed advice.

For further information on how low-hydroxyl quartz reaction tubes can improve your CHN microanalytical data please contact Exeter Analytical.

-----------

European HQ

Exeter Analytical (UK) Ltd.
University of Warwick Science Park
Barclays Venture Centre
Sir William Lyons Road
Coventry CV4 7 EZ
UK

tel. +44-2476-323223
fax +44-2476-323221
email info@exeteranalytical.co.uk

-----

North America HQ

Exeter Analytical Inc
Chelmsford, MA USA

tel. +1-978-251-1411
fax +1-978-251-4536
Email sales@eai1.com

Activotec (www.activotec.com) has established a strong international reputation for being able to provide a wide range of amino acids, resins and reagents for peptide synthesis and organic chemistry, many being available on fast delivery from stock.

A challenge faced by many laboratories today is to synthesise long, complex and highly hydrophobic peptides. For this purpose, Activotec offers a novel 100% PEG resin that has demonstrated tremendous advantages over polystyrene. In addition to offering researchers custom synthesis of solid phase chemistry resins - Activotec maintains a comprehensive catalogue of more than 300 different standard resins, scavengers, supported reagents and preloaded resins.

Amino acids, due to their availability, multi-functionality, structural diversity and versatility, are important tools for drug discovery, combinatorial chemistry and stereoselective synthesis. Activotec offers one of the widest selections of amino acids derivatives. Activotec's comprehensive product line covers the full range of standard protected amino acids, hundreds of unusual amino acids as well as Boc, Fmoc and Cbz N-protected amino acids.

Investment in top quality personnel and the latest equipment enables Activotec to provide the amino acids, resins and reagents of your choice from gram to multi-kilogram quantities and supply your needs from R&D/Discovery to drug launch with the lowest possible cost in a timely fashion. All amino acids, resins and reagents come with a Certificate of Analysis.

Activotec is a customer-focused company providing a range of products and services for peptide synthesis including automated peptide synthesizers, custom peptide synthesis, peptide R&D and chemicals.

For further information on high performance amino acids, resins and reagents for peptide synthesis and organic chemistry please contact Activotec.

-----------

Worldwide HQ

Activotec
7 Bennell Court
West Street
Comberton
Cambridge CB23 7EN
UK

tel. +44-1223-260008
email info@activotec.com
web www.activotec.com

For laboratories looking to reduce sample contamination the new Micronic Tube Selector enables 'hands-free' manual picking and placing of sample tubes from any storage rack.

Offering the convenience of single-handed operation the Tube Selector is very easy to use. A single thumb button enables rapid and secure picking of a storage tube. Pressing the thumb button again releases the tube from the Tube Selector. An easy wipe clean surface further reduces the chances of sample contamination.

Compatible with all standard SBS format 96-rack tubes the versatile Tube Selector is available as a low cost stand-alone product or as part of a Micronic starter pack.

Micronic offers a range of low cost Starter Packs for organisations looking to implement traceable sample storage work practices. Micronic Starter Packs contain everything needed to start using alphanumeric to 2D coded and non-coded sample storage tubes enabling laboratory workers to ensure a secure sample logistics system and eliminate the costly possibility of false sample identities. Each attractively priced pack contains an easy-to-use tube scanner, operating software, a case of racked tubes, CapCluster multi-piercable tube caps, a versatile plate sealing device and manual tube decappers.

Dedicated to the design and production of innovative sample storage tubes, accessories and instruments, Micronic offers a wide range of highly affordable sample storage solutions allowing researchers to securely organise their samples in the minimal amount of space. Micronic tubes are available in non-coded, alpha numeric coded and 2D bar coded formats and in a variety of different sizes and materials to suit almost any storage application.

For further information on the Tube Selector and Starter Packs please contact Micronic Europe now on telephone +31-320-2770770, email sales@micronic.com or visit the company website www.micronic.com

---------------------

Worldwide HQ

Micronic BV
Platinastraat 51 8211 AR
P.O. Box 604
8200 AP Lelystad
The Netherlands

tel. +31-320-277070
email sales@micronic.com
web www.micronic.com

North America HQ

Micronic NA
PMB 301
McMurray PA 15317
USA

tel. +1-724-941-6411
email sales@micronic.com
web www.micronicna.com

Strategic US partners - Integra Biosciences AG and the Viaflo Corporation have selected Neuroscience 2008 to show for the first time their comprehensive combined portfolio of high quality liquid handling products.

Visitors to Booth 326 will be introduced to a new range of handheld electronic pipettors. VOYAGER™ is a novel single-handed, adjustable-spacing, multi-channel pipettor that supports sample transfers between different labware formats. VISION® is the industry's first handheld electronic pipettor range that can be controlled with an intuitive touch wheel user interface over four-colour display.

At this important meeting, VIAFLO / INTEGRA Biosciences will also be showing and demonstrating further liquid handling products including the lightweight PIPETBOY serological pipettor and the DOSE IT peristaltic pump. The DOSE IT peristaltic pump makes the dispensing of culture media, buffers and other solutions easy and efficient. An intuitive multilingual user interface, coupled with large ergonomically designed display and keypad, makes the DOSE IT extremely simple to program and operate. Providing high accuracy dispensing across a broad range of dose volumes (0.1 ml - 10 L) and flow rates (0.6 ml/min - 5L/ min) the versatility of the DOSE IT reduces the need for a laboratory to have several single-purpose pumps.

For laboratories looking for safe, easy and rapid aspiration of biohazardous liquids technical staff will be on hand to demonstrate the popular VACUSAFE comfort system. Incorporating pump unit, waste collection bottle, tubing and VACUBOY hand operator in an all-in-one compact instrument, the VACUSAFE comfort is a highly safe aspiration system that readily fits below all commercially available laminar flow cabinets.

Other products on display of interest to neuroscience researchers will include the new generation FIREBOY - an intrinsically safe and mobile alternative to the traditional Bunsen burner.

For further information on these innovative lab tools, please contact Viaflo / INTEGRA Biosciences on telephone +1-603-578-5800 / +41-81-286-9530 or email info@integra-biosciences.com

---------------------

Worldwide HQ

INTEGRA Biosciences
CHUR, Switzerland

Tel: + 41 81 286 9530
Email: info@integra-biosciences.com
www.integra-biosciences.com

USA

INTEGRA Biosciences / Viaflo Corporation
Hudson, NH 03051
USA

tel. +1 603 578 5800
www.viaflo.com

Micronic, specialists in sample storage, offers a wide range of low cost, flat bottom non coded and alphanumeric tubes (0.5ml, 0.75ml, 1.1ml and 1.4ml) available on short delivery times. Adopting a standard Micronic tube profile the flat bottom tubes offer users an easy upgrade path to using 2D coded tubes in future.

Incorporating a smooth external flat surface makes Micronic flat bottom sample tubes an easier to read and identify alternative to traditional round bottom tubes for automated scanning applications. The optimised internal 'v' or 'u' bottom shape provides the lowest dead volume and enables maximum sample recovery.

Manufactured from highest medical grade polypropylene in a fully automated class 7 cleanroom environment ensures Micronic flat bottom alphanumeric tubes exhibit absolute product consistency, near zero contaminants and compliance with US and European Pharmacopoeia tests. Micronic flat bottom alphanumeric tubes resist many organic solvents (DMSO, methanol, dichloromethane), may be autoclaved clean and can be repeatedly freeze-thawed without loss of product performance.

Dedicated to the design and production of innovative sample storage tubes, accessories and instruments, Micronic offers a wide range of highly affordable sample storage solutions allowing researchers to securely organise their samples in the minimal amount of space. Micronic tubes are available in non-coded, alpha numeric coded and 2D bar coded formats and in a variety of different sizes and materials to suit almost any storage application.

For further information on flat bottom alphanumeric tubes please contact Micronic now.

---------------------

Worldwide HQ

Micronic BV
Platinastraat 51 8211 AR
P.O. Box 604
8200 AP Lelystad
The Netherlands

tel. +31-320-277070
email sales@micronic.com
web www.micronic.com

North America HQ

Micronic NA
PMB 301
McMurray PA 15317
USA

tel. +1-724-941-6411
email sales@micronic.com
web www.micronicna.com

AnaSpec, one of the world’s leading providers of custom and catalog peptides, has introduced ClearPoint™ Peptides, heavy isotope-labeled peptides for absolute quantitation (AQUA) of proteins.

The use of mass spectrometry (MS) has helped advanced proteomics research by providing qualitative information of thousands of known and unknown proteins. By spiking protein tryptic digests with internal heavy isotope labeled peptide standards, MS becomes an absolute quantitation (AQUA) method.1

AnaSpec’s ClearPoint™ peptides offer a choice of heavy hydrogen (2H), carbon (13C), or nitrogen (15N)-isotopes specifically labeled at single, multiple or universal positions. They are available as both custom or catalog peptides.

Company Info

AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents (dyes, assay kits, & antibodies), and combinatorial chemistry.

For more information, visit www.anaspec.com

Reference:
Harding, S. (ed.) 2007. Biotechnology & Genetic Engineering Reviews. Nottingham University Press, Nottingham.

For more information, contact us at:
http://www.anaspec.com/
Address: 2149 O'Toole Avenue, San Jose, CA 95131 USA
Phone: +1 408 452 5055
USA and Canada: Toll free on +1 800 452 5530
Email: service@anaspec.com

Agilent Technologies Inc., (NYSE: A) today announced that it has acquired a license to commercialize a method developed at the Broad Institute for genome partitioning using Agilent’s Oligo Library Synthesis (OLS) technology. Financial terms were not disclosed.

Recent advances in DNA-sequencing technology have increased the speed of data acquisition. However, without accompanying improvements in the ability to select relevant portions of the genome, the technology cannot achieve its full potential in studying the relationships between genes and diseases. The Agilent genome-partitioning portfolio, which is currently in development, holds great potential for eliminating this bottleneck by enabling users to efficiently design and acquire ready-to-use, custom mixtures of biotinylated long RNA probes in a single tube.

Chad Nusbaum, Ph.D., co-director of the Genome Sequencing and Analysis Program at the Broad Institute, described the improved method at an Agilent customer event recently at the American Association of Cancer Research meeting in San Diego, Calif.

“We’re working on a simple, highly multiplexed, cost-effective way to enable investigators to remove the sample-preparation bottleneck in sequencing targeted regions of mammalian genomes, using relatively small amounts of input DNA,” Nusbaum said. “Agilent’s expertise in custom oligo synthesis and our expertise in production-scale sequencing are a natural match-up to overcome these challenges.”

“The Broad is part of our early-access program, in which we made oligo library synthesis capability available to a select number of luminaries to find out how these creative scientists could use custom complex mixtures of long oligonucleotides,” said Yvonne Linney, Ph.D., Agilent vice president and general manager, Genomics. “This work to eliminate the sample preparation bottleneck of next-generation sequencing will greatly accelerate our understanding of how genes operate.”

Agilent plans to offer kits containing custom mixtures of long biotinylated RNA molecules that can efficiently capture 5-10 megabases of genomic DNA sample in a single tube. The method is based on the combination of the Agilent SurePrint platform, capable of synthesizing high-quality oligo mixtures, and the protocols developed by the Broad Institute to transform these into RNA probes.

These RNA probes can, in turn, be used to capture genomic regions of interest in a simple, scalable and highly multiplexed manner, greatly simplifying the process for targeted re-sequencing.

“The ability to perform the capture reaction in a small volume solution enables a significant increase in the kinetic efficiency and enables users to scale from tens to thousands of samples without adding significant personnel,” said Emily LeProust, Ph.D., Agilent R&D Chemistry and Genome Partitioning program manager.

In February, a researcher from Nusbaum’s group presented a paper at the Advances in Genome and Biology Technology conference, describing the use of Agilent Oligo Libraries, the basis of the genome partitioning capability and next-generation sequencing to correctly identify several previously known mutations and several new ones in certain tumor types.

Linney said that this is also an example of how Agilent is leveraging the reagent manufacturing expertise of Stratagene, which joined Agilent in June 2007, to provide high-quality, cost-effective solutions.

The Broad Institute is a research collaboration of the Massachusetts Institute of Technology and Harvard University.

For more information, contact us at:
http://www.agilent.com/
Address: Agilent Technologies UK Limited, Life Sciences & Chemical Analysis Group, Lakeside, Cheadle Royal Business Park, Stockport, Cheshire, SK8 3GR
Phone: +44 (0)161 492 7500
Email: cag_enquiry@agilent.com

The TENAK Origami is a newly developed cryobox concept. The name Origami is inspired by the Jananese art form "Origami" which means "Folding Paper".

The basic idea of the concept is a cryobox which is delivered "Plano" and you will have to fold it yourself. The advantages of this is, that you get an inexpensive cryobox, which takes up little space and therefore is cheap to ship and doesn't take up a lot of space in your laboratory.

The TENAK Origami consists of a lid and a bottom. Simply follow the instruction on the lid, 1-2-3 and you have a stable, high quality cryobox.

The TENAK Origami cryobox is available in the most used size with a height of 50mm. The square measure is 134x134mm which makes it fit into all storage rack systems.

Go to our homepage to get a free sample.

This week AnaSpec, a world leader in integrated proteomics solutions, introduced fifty (50) new catalog peptides and one (1) new fluorescent dye.

Hylambatin- Cat# 62792
Hylambatin belongs to the tachykinins. Hylambatin was isolated from Kassina maculata (African rhacophorid frog; Hylambates maculatus) and is expressed in skin glands. It is an amphibian defense peptide.
Sequence: DPPDPDRFYGMM-NH2

[Lys6]-Eledoisin (6-11)- Cat# 62627
This amino acids 6 to 11 fragment of eledoisin with Ala6 substituted by Lys6 is a peptide of mollusk origin. It is a member of the tachykinin family of neuropeptides. Eledoisin was first isolated from the posterior salivary glands of two mollusk species Eledone muschata and E. aldovandi. All tachykinin peptides; including eledoisin; share the same consensus C-terminal sequence Phe-Xxx-Gly-Leu-Met-NH2. These peptides exhibit a wide and complex spectrum of pharmacological and physiological activities such as powerful vasodilation; hypertensive action; and stimulation of extravascular smooth muscle.
Sequence: KFIGLM-NH2

Ranatachykinin C- Cat# 62778
This ranatachykinin C peptide was isolated from the frog (Rana catesbeiana) brain and intestine. It exhibits potent stimulant effect on smooth muscle preparation of guinea pig ileum. This is one of four known ranatachykinin peptides. Ranatachykinins A; B and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a sequence common to known members of the tachykinin family.
Sequence: HNPASFIGLM-NH2

Ranatachykinin B- Cat# 62777
This ranatachykinin B peptide was isolated from the frog (Rana catesbeiana) brain and intestine. It exhibits potent stimulant effect on smooth muscle preparation of guinea pig ileum. This is one of four ranatachykinin peptides. Ranatachykinins A; B and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a sequence common to known members of the tachykinin family.
Sequence: YKSDSFYGLM-NH2

Histone H4 (1-7); N-Terminal- Cat# 62754
This is amino acids 1 to 7 fragment of the histone H3. Alterations in chromatin structure; such as nucleosome sliding; removal of nucleosomes; and disruption of DNA–histone or histone–histone contacts through post-translational modification of the histones; have been linked to transcriptional regulation; DNA damage repair; and replication; among other cellular processes. Modification of histones occurs primarily in the N-terminal residues or tail region. These modifications include phosphorylation; ubiquitinylation; methylation; sumolyation; and acetylation. Lys5 may serve as the acetylation site for this peptide.
Sequence: SGRGKGG

AMARA peptide- Cat# 62596
AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence: AMARAASAAALARRR

Catestatin; human- Cat# 62513
Catestatin is amino acids 352 to 372 fragment of chromogranin A . Chromogranin A is the endogenous compound that is able to inhibit catecholamine release elicited by the activation of neuronal nicotinic acetylcholine receptors (nAChRs). nAChRs are found in different animal species and catecholaminergic cell types.
Sequence: SSMKLSFRARAYGFRGPGPL

Valorphin- Cat# 62789
Valorphin is an opioid-like fragment of hemoglobin b-chain. Valorphin was isolated from bovine hypothalamic tissue. It possesses some opiate activity.
Sequence: VVYPWTQ

LVV-Hemorphin-6; Leu-Valorphin-Arg- Cat# 62790
This peptide is amino acids 32 to 40 fragment of the beta-; delta-; gamma; and sigma-chains of human hemoglobin. It possesses some opiate activity. This peptide was isolated from the pituitary gland.
Sequence: LVVYPWTQR

MOG (101-120); human; mouse- Cat# 62370
This is amino acids 101 to 120 fragment of myelin oligodendrocyte glycoprotein (MOG); one of the major MOG B-cell epitopes in transgenic mice. MOG is a potential target antigen of the central nervous system known to induce autoreactive T cell response and demyelinating anti-MOG antibodies in multiple sclerosis (MS) patients. Studies demonstrated that a quantitatively minor myelin protein; MOG; is also strongly encephalogenic in mice; rats; marmosets; and rhesus monkeys; which is highly relevant to MS.
Sequence: RDHSYQEEAAMELKVEDPFY

Pevpyrokinin-2 (PPK-2; Pev-PK 2)- Cat# 62775
This pevpyrokinin-2 (PPK-2; Pev-PK 2) peptide belongs to the pyrokinin neuropeptides and was isolated from white shrimp. Extract of 3500 central nervous systems of female white shrimp Penaeus vannamei was screened for myotropic activity in order to purify pyrokinin-like peptides that belong to the pyrokinin/PBAN neuropeptide family. Members of this family regulate reproductive processes in insects; including pheromone biosynthesis. The crustacean pyrokinins are the first to be found in a non insect. PK peptides share the conserved C-terminal pentapeptide sequence FXPRLamide; where X is a variable amino acid
Sequence: ADFAFSPRL-NH2

Pevpyrokinin-1 (PPK-1; Pev-PK 1)- Cat# 62774
This pevpyrokinin-1 peptide was isolated from the central nervous systems of female white shrimp; Penaeus vannamei. Pev-PK 1 contains the typical FXPRL-NH2 (X = G; S; T or V) C-terminal sequence that characterizes members of the versatile pyrokinin/PBAN family These crustacean pyrokinins are the first to be found in a noninsect. Pev-PK 1 and Pev-PK 2 synthetic peptides display myotropic activity on the Leucophaea maderae as well as on the Astacus leptodactylus hindgut.
Sequence: DFAFSPRL-NH2

Myomodulin- Cat# 62796
Myomodulin is a bioactive neuropeptide found in Aplysia neurons. It produces a hyperpolarization in several Achatina neuron types.
Sequence: PMSMLRL-NH2

Leucokinin 3- Cat# 62799
Leucokinin-3 is an insect neuropeptide derived from Leucophaea maderae. This peptide stimulates contractile activity of cockroach protodeum (hindgut).
Sequence: DQGFNSWG-NH2

Secretogranin I Precursor (585-594)- Cat# 62662
This peptide is amino acids 585 to 594 fragment of the secretogranin I precursor. The same sequence belongs to the mature peptide; chromogranin B; parathyroid secretory protein in rat.
Sequence: SFAKAPHLDL

Pituitary Adenylate Cyclase-Activating Polypeptide Precursor (111-128)- Cat# 62675
This is amino acids 111 to 128 fragment of the pituitary adenylate cyclase-activating polypeptide precursor; also known as PACA_RAT 111.
Sequence: GMGENLAAAAVDDRAPLT

Gonadoliberin I (24-33)- Cat# 62671
This is amino acids 24 to 33 fragment of gonadoliberin 1; or gonadotropin-releasing hormone I (GnRH I). It is identical in mouse; rat; human; sheep; cow; pig; etc. The hypothalamic-pituitary GnRH system is composed of GnRH-I decapeptide hormone; and type I GnRH receptors which are involved in the regulation of gonadotrophin secretion from the anterior pituitary gland.
Sequence: QHWSYGLRPG

Delta-Sleep-Inducing Peptide (DSIP)- Cat# 62787
This delta-sleep-inducing peptide (DSIP) was isolated from rabbits. It induces slow-wave (delta) and spindles electroencephalogram enhancement after intraventricular (brain) infusion.
Sequence: WAGGDASGE

CART Protein Precursor (82-86)- Cat# 62707
This is amino acids 82 to 86 fragment of the cocaine- and amphetamine-regulated transcript (CART) Protein Precursor; or amino acids 55 to 59 fragment of CART. This is a section of the rat long form (rl) CART 55-102 bioactive peptide that opposes the actions of cocaine.
Sequence: IPIYE

alpha-Neo-Endorphin- Cat# 62678
Alpha-Neo-Endorphin(alpha-NE) is a cleavage product of the prodynorphin. Alpha-NE has been isolated from all vertebrates phyla; and from different tetrapods where it shows similar biochemical properties; reflecting the great conservation of this peptide in tetrapods.
Sequence: YGGFLRKYPK

Ecdysis-Triggering Hormone 1 (ETH1); Drosophila- Cat# 62801
This peptide is an insect ecdysis-triggering hormone (ETH). Inka cells from the epitracheal glands produce hormones that are involved in regulation of insect ecdysis. Injection of ETH is sufficient to elicit the entire ecdysis behavior.
Sequence: DDSSPGFFLKITKNVPRL-NH2

Preptin; Human Pro-Insulin Growth Factor II (69-80); mouse- Cat# 62431
This peptide belongs to the mouse preptin. Preptin is a recently isolated 34-amino acid peptide hormone that is co-secreted with insulin and amylin from the pancreatic beta-cells. Preptin corresponds to Asp69-Leu102 of pro-insulin growth factor II (pro-IGF-II). Increased circulating levels of a pro-IGF-II peptide complexed with IGF-binding protein-2 have been implicated in the high bone mass phenotype observed in patients with chronic hepatitis C infection.
Sequence: DVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRL

MOG (92–106)- Cat# 62732
This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein (MOG). Mice with MOG (92–106)-induced experimental autoimmune encephalomyelitis develop extensive B cell reactivity against secondary myelin antigens. Despite the fact that this MOG peptide induces only weak T cell responses; MOG-induced autoimmunity is very severe. This peptide is encephalitogenic in SJL mice; DA rats; and rhesus monkeys.
Sequence: DEGGYTCFFRDHSYQ

P2 p57–81; Peripheral Myelin P2 Protein p57–81- Cat# 62083
This peptide was used to study the experimental autoimmune encephalomyelitis (EAE) and induction of transferred EAE in mice. It is a neurotogenic peptide of P2 peripheral myelin.
Sequence: FKNTEISKLGQEFEETTADNRKTK

MBP (79-87)- Cat# 62733
This is an amino acids 79 to 87 fragment of the myelin basic protein (MBP). Injection of this peptide induces a high avidity T cell repertoire in shiverer mice that primarily consisted of clones capable of recognizing the native MBP protein; in addition to the peptide itself. Endogenous MBP is not required for the positive selection of an MBP-specific T cell repertoire. C3H mice; in contrast; are selectively unresponsive to the MBP protein and injection of this MBP peptide induces a low avidity repertoire that could be stimulated only by the peptide; not by the protein.
Sequence: DENPVVHFF

NY-ESO-1 (87-111)- Cat# 62655
This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast; prostate; lung; and melanoma) and by male germline cells; but not by other normal tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4 molecules; including HLA-DRB1*0101; 0401; 0701; and 1101 and HLA-DPB1*0401 and 0402 molecules.
Sequence: LLEFYLAMPFATPMEAELARRSLAQ

BDC2.5 mimotope 1040-51- Cat# 62755
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5. from non-obese diabetic (NOD) mice. T cells from prediabetic and diabetic NODs respond to BDC2.5 mimotope peptides. This peptide is important in autoimmune diabetes research.
Sequence: RVLPLWVRME

BDC2.5 mimotope 1040-31- Cat# 62756
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5. It can stimulate BDC2.5 cells with cells showing good response to this mimotope. 1040-31 peptide is specific for BDC2.5 TCR Tg+ (transgenic) T cells. This peptide is also known as p31.
Sequence: YVRPLWVRME

MMK-1; amide- Cat# 62520
This is a formyl peptide receptor like 1 (FPRL1 ) antagonist peptide. MMK-1 was reported to mobilize Ca2+ via lipoxin A4 receptors (ALXRs); and to stimulate human polymorphonuclear leukocyte chemotaxis.
Sequence: LESIFRSLLFRVM-NH2

Dyrktide; TAMRA labeled- Cat# 62715
Dyrktide is designed as the optimal substrate sequence that is efficiently phosphorylated by DYRK1A. DYRK1A is a dual-specificity protein kinase that is thought to be involved in brain development. This peptide is labeled with TAMRA at the N-terminus; Abs/Em = 544 nm/ 572 nm..
Sequence: 5-TAMRA-RRRFRPASPLRGPPK

Autoimmune Lupus Erythematosus Epitope 1- Cat# 62726
This small nuclear ribonucleoprotein Sm autoantigen B/B'-derived octapeptide is recognized by lupus erythematosus auto-antibodies. Autoantibodies binding the Sm B and Sm B/B? peptides are commonly associated with systemic lupus erythematosus in man and in MRLlpr/lpr mice. This region of Sm B/B? is a major area of antigenicity in human sera.
Sequence: PPPGIRGP

Heparin-Binding Peptide V; scrambled- Cat# 62705
This is a scrambled sequence of the heparin-binding peptide V which is derived from the III14 repeat of heparin-binding fibronectin fragment (HBFN-f). HBFN-f stimulates NO production in a dose-dependent manner. Peptide V with heparin-binding ability significantly reduces NO levels elevated by HBFN-f.
Sequence: RPQIPWAR

Orphanin FQ2; (OFQ2; NOCII)- Cat# 62609
Orphanin FQ2 (OFQ2); or NOCII; is a heptadecapeptide generated from prepronociceptin (PPNOC); the same precursor as for nociceptin/orphanin FQ and nocistatin. NOCII is a potent analgesic when administered both supraspinally and spinally. Intracerebroventricular administration of NOCII increases locomotion in mice. NOCII is a peptide whose sequence lies immediately downstream of nociceptin; the natural agonist of the ORL1 receptor. The sequence of NOCII is framed by putative convertase excision sites; and is totally conserved across murine and human species.
Sequence: FSEFMRQYLVLSMQSSQ

BQ123; Cyclo(-wdPvL-); Endothelin Antagonist- Cat# 62357
This peptide is a selective endothelin antagonist; a part of the Ca2+ metabolism. BQ-123 is a non-competitive antagonist of the actions of endothelin-1 in SK-N-MC human neuroblastoma cells.
Sequence: Cyclo(-wdPvL-)

Deltorphin B- Cat# 62683
Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa bicolor.
Sequence: YaFEVVG-NH2

Deltorphin C- Cat# 62681
Deltorphin C; also known as deltorphin 1 is delta-opioid receptor agonist.
Sequence: YaFDVVG-NH2

Dynorphin B (1-9)- Cat# 62687
This is amino acids 1 to 9 fragment of the dynorphin B.
Sequence: YGGFLRRQF

Dynorphin B (1-13)- Cat# 62686
This is amino acids 1 to 13 fragment of the dynorphin B; also known as Rimorphin Rimorphin is generated from dynorphin B-29 (leumorphin) by the cleavage at a single Arg residue. Rimorphin has been purified from extracts of bovine posterior pituitary glands. This unique peptide is a major [Leu]-enkephalin-containing peptide in all tissues examined that contain dynorphin and alpha-neo-endorphin. A rat brain membrane extract was also shown to convert synthetic dynorphin B-29 to rimorphin.
Sequence: YGGFLRRQFKVVT

Dermorphin- Cat# 62684
This peptide is ?-opioid receptor agonist
Sequence: YaFGYPS

Lipid Membrane Translocating Peptide; D-isomer- Cat# 62398
This is an all d-amino acids sequence of the lipid membrane translocating peptide. It is a drug delivery peptide that is able to penetrate the lipid membranes.
Sequence: kkaaavllpvllaap

Survivin 2B (80–88)- Cat# 62693
This peptide is amino acids 80 to 88 fragment of survivin-2B. It is capable of binding to HLA-A24. This peptide is a potent T-cell epitope eliciting CTL response against a splicing variant survivin-2B; which is specifically expressed in many kinds of cancer cells.
Sequence: AYACNTSTL

Tyrosinase (240-251)- Cat# 62711
This is amino acids 240 to 251 fragment of tyrosinase; the HLA-A1-restricted epitope. This peptide is a incredibly immunogenic epitope used in melanoma vaccines studies.
Sequence: DAEKSDICTDEY

MAGE-A 1(96–104)- Cat# 62709
This is amino acids 96 to 191 fragment of the MAGE-A1. This peptide is immunogenic when administered to patients with stage IIB; III; or IV melanoma. It is considered for inclusion in vaccines against cancers of many histologic types; in addition to melanoma.
Sequence: SLFRAVITK

Metalnikowin IIA- Cat# 62602
Metalnikowin IIA is an antibacterial peptide active against Gram-negative bacteria.
Sequence: VDKPDYRPRPWPRPN

Drosocin- Cat# 62600
Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.
Sequence: GKPRPYSPRPTSHPRPIRV

HspB8 (184-196); human- Cat# 62592
This is amino acids 184 to 196 fragment of the heat shock protein HspB8. The C-terminal domain of HspB8 is necessary for chaperone activity. HspB8 is highly expressed in the neuronal tissue; heart; brain. It was shown to affect on beta-amyloid-mediated cytotoxicity; beta-amyloid aggregation and development of senile plaques in Alzheimer's and other neurodegenerative diseases.
Sequence: NELPQDSQEVTCT

[Pro31]-Beta-Amyloid (1-42)- Cat# 62443
This beta-amyloid peptide (1-42) has Ile31 substituted with Pro31. Substitution of Ile31 by the helix-breaking amino acid; proline; completely abrogates the oxidative stress and neurotoxic properties of beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA

[Val33]-Beta-Amyloid (1-42)- Cat# 62442
This modified amino acids 1 to 42 fragment of the beta amyloid peptide has substitution of Gly33 to Val33. This peptide shows almost no neuronal toxicity compared to the native beta amyloid (1-42); as well as having significantly lowered levels of oxidized proteins. It does not form fibrils nearly as well as beta amyloid (1- 42); suggesting that Gly33 may be a possible site of free radical propagation processes and contributes to the peptide’s toxicity in Alzheimer’s disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIVLMVGGVVIA

[Asn 6;13;14] -Beta-Amyloid (1-42)- Cat# 61958-01
This is a modified beta-amyloid (1-42) peptide; with histidines at positions 6; 13 and 14 replaced by asparagines.
Sequence: DAEFRNDSGYEVNNQKLVFFAEDVGSNKGAIIGLMVGGVVIA

gp100 (25–33); human- Cat# 62589
This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific; H-2Db-restricted; CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL

Acrylodan- Cat# 83305

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to pharmaceutical, biotech, and academic research institutions throughout the world. With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry. Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

For more information visit www.anaspec.com